IL28B (IFNL3) (NM_172139) Human Recombinant Protein

CAT#: TP318965SE

Purified recombinant protein of Human interleukin 28B (interferon, lambda 3) (IL28B), (Secreted), 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2200.00


货期*
2周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Rabbit Polyclonal IL-28B Antibody
    • 100 ug

CNY 5808.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC218965 representing NM_172139
Red=Cloning site Green=Tags(s)

MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCK
CRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQ
PTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.2 kDa
Concentration >50 ug/mL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
Preparation Conditioned medium was collected from overexpressed HEK293 cells. Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_742151
Locus ID 282617
UniProt ID Q8IZI9
Refseq Size 595
Cytogenetics 19q13.2
Refseq ORF 588
Synonyms IFN-lambda-3; IFN-lambda-4; IL-28B; IL-28C; IL28B; IL28C
Summary This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...