EFCAB4B (CRACR2A) (NM_032680) Human Recombinant Protein
CAT#: TP319097
Recombinant protein of human EF-hand calcium binding domain 4B (EFCAB4B), transcript variant 3, 20 µg
View other "EFCAB4B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219097 representing NM_032680
Red=Cloning site Green=Tags(s) MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFI ARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKV YLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDFLTRIISQLQE AHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQL TQKQKRLEGQCTALHHDKHETKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEME VYRVTESLQREKAGLLKQLDFLRCVGGHWPVLRAPPRSLGSEGPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116069 |
Locus ID | 84766 |
UniProt ID | Q9BSW2 |
Refseq Size | 2204 |
Cytogenetics | 12p13.32 |
Refseq ORF | 1185 |
Synonyms | EFCAB4B |
Summary | Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409980 | CRACR2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409980 | Transient overexpression lysate of EF-hand calcium binding domain 4B (EFCAB4B), transcript variant 3 |
CNY 3080.00 |
|
PH319097 | EFCAB4B MS Standard C13 and N15-labeled recombinant protein (NP_116069) |
CNY 19520.00 |
其它EFCAB4B产品