Epac1 (RAPGEF3) (NM_001098532) Human Recombinant Protein
CAT#: TP319138
Recombinant protein of human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3, 20 µg
View other "Epac1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219138 representing NM_001098532
Red=Cloning site Green=Tags(s) MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATC PNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFY RFPGPEPEPVGTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEELLHIKAVAHLSNS VKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRA ATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGT PEKILELLLEAMGPDSSAHDPTETFLSDFLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKR QQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMK ARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQVLV KVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTD HDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLA AHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALAKLSPPVI PFMPLLLKDMTFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARI STCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 99.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001092002 |
| Locus ID | 10411 |
| UniProt ID | O95398 |
| Refseq Size | 3425 |
| Cytogenetics | 12q13.11 |
| Refseq ORF | 2643 |
| Synonyms | bcm910; CAMP-GEFI; EPAC; EPAC1; HSU79275 |
| Summary | Guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which it activates the PI3K gamma complex and which is involved in angiogenesis. Plays a role in the modulation of the cAMP-induced dynamic control of endothelial barrier function through a pathway that is independent on Rho-mediated signaling. Required for the actin rearrangement at cell-cell junctions, such as stress fibers and junctional actin.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Leukocyte transendothelial migration, Long-term potentiation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401841 | RAPGEF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420629 | RAPGEF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401841 | Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2 |
CNY 3080.00 |
|
| LY420629 | Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3 |
CNY 4840.00 |
|
| PH304518 | RAPGEF3 MS Standard C13 and N15-labeled recombinant protein (NP_006096) |
CNY 19520.00 |
|
| PH319138 | RAPGEF3 MS Standard C13 and N15-labeled recombinant protein (NP_001092002) |
CNY 19520.00 |
|
| TP304518 | Recombinant protein of human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2, 20 µg |
CNY 2900.00 |
