SNX18 (NM_001102575) Human Recombinant Protein
CAT#: TP319205
Purified recombinant protein of Homo sapiens sorting nexin 18 (SNX18), transcript variant 1, 20 µg
View other "SNX18" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219205 representing NM_001102575
Red=Cloning site Green=Tags(s) MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVQVIRAPEPGPAGDG GPGAPARYANVPPGGFEPLPVAPPASFKPPPDAFQALLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQL YGGYQASQGSDDDWDDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSV PPQHHPSGPKSSATVSRNLNRFSTFVKSGGEAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTI DDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFIS KRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD LQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLN QAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEV QKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEALHKYDSV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 68.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001096045 |
| Locus ID | 112574 |
| UniProt ID | Q96RF0 |
| Refseq Size | 5238 |
| Cytogenetics | 5q11.2 |
| Refseq ORF | 1872 |
| Synonyms | SH3PX2; SH3PXD3B; SNAG1 |
| Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403272 | SNX18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420160 | SNX18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403272 | Transient overexpression lysate of sorting nexin 18 (SNX18), transcript variant 2 |
CNY 4840.00 |
|
| LY420160 | Transient overexpression lysate of sorting nexin 18 (SNX18), transcript variant 1 |
CNY 4840.00 |
|
| PH319205 | SNX18 MS Standard C13 and N15-labeled recombinant protein (NP_001096045) |
CNY 14250.00 |
