VPS29 (NM_016226) Human Recombinant Protein
CAT#: TP319311
Recombinant protein of human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1, 20 µg
View other "VPS29" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219311 representing NM_016226
Red=Cloning site Green=Tags(s) MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYP EQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYN ALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057310 |
| Locus ID | 51699 |
| UniProt ID | Q9UBQ0 |
| Refseq Size | 1095 |
| Cytogenetics | 12q24.11 |
| Refseq ORF | 546 |
| Synonyms | DC7; DC15; PEP11 |
| Summary | This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. This VPS protein may be involved in the formation of the inner shell of the retromer coat for retrograde vesicles leaving the prevacuolar compartment. Alternative splice variants encoding different isoforms and representing non-protein coding transcripts have been found for this gene. [provided by RefSeq, Aug 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409254 | VPS29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414109 | VPS29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409254 | Transient overexpression lysate of vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2 |
CNY 3080.00 |
|
| LY414109 | Transient overexpression lysate of vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 1 |
CNY 3080.00 |
|
| PH301460 | VPS29 MS Standard C13 and N15-labeled recombinant protein (NP_476528) |
CNY 14250.00 |
|
| PH319311 | VPS29 MS Standard C13 and N15-labeled recombinant protein (NP_057310) |
CNY 19520.00 |
|
| TP301460 | Recombinant protein of human vacuolar protein sorting 29 homolog (S. cerevisiae) (VPS29), transcript variant 2, 20 µg |
CNY 2900.00 |
