hnRNP A2B1 (HNRNPA2B1) (NM_002137) Human Recombinant Protein
CAT#: TP319318
Recombinant protein of human heterogeneous nuclear ribonucleoprotein A2/B1 (HNRNPA2B1), transcript variant A2, 20 µg
View other "hnRNP A2B1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219318 representing NM_002137
Red=Cloning site Green=Tags(s) MEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAAR PHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKK RGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPG PGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGG GNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Surface Plasmon Ressonance (SPR) (PMID: 28338097) Taq polymerase stop assay (binding assay) (PMID: 28338097) |
| Reference Data | |
| RefSeq | NP_002128 |
| Locus ID | 3181 |
| UniProt ID | P22626 |
| Refseq Size | 1714 |
| Cytogenetics | 7p15.2 |
| Refseq ORF | 1023 |
| Synonyms | HNRNPA2; HNRNPB1; HNRPA2; HNRPA2B1; HNRPB1; IBMPFD2; RNPA2; SNRPB1 |
| Summary | This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The cellular protein hnRNP A2/B1 enhances HIV-1 transcription by unfolding LTR promoter G-quadruplexes
,Scalabrin, M;Frasson, I;Ruggiero, E;Perrone, R;Tosoni, E;Lago, S;Tassinari, M;Palù, G;Richter, SN;,
Sci Rep
,PubMed ID 28338097
[HNRNPA2B1]
|
|
Sumoylated hnRNPA2B1 controls the sorting of miRNAs into exosomes through binding to specific motifs
,null,
Nature Communications
,PubMed ID 24356509
[HNRNPA2B1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424979 | HNRNPA2B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424979 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A2/B1 (HNRNPA2B1), transcript variant A2 |
CNY 3080.00 |
|
| PH319318 | HNRNPA2B1 MS Standard C13 and N15-labeled recombinant protein (NP_002128) |
CNY 19520.00 |
|
| PH324241 | HNRNPA2B1 MS Standard C13 and N15-labeled recombinant protein (NP_112533) |
CNY 14250.00 |
|
| TP324241 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein A2/B1 (HNRNPA2B1), transcript variant B1, 20 µg |
CNY 2900.00 |
其它hnRNP A2B1产品
