PLA1A (NM_015900) Human Recombinant Protein
CAT#: TP319486
Purified recombinant protein of Homo sapiens phospholipase A1 member A (PLA1A), 20 µg
View other "PLA1A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219486 representing NM_015900
Red=Cloning site Green=Tags(s) MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGS SDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLS LEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRASVEERLDAGDA LFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAF PCASYKAFLAGRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKEL RNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056984 |
| Locus ID | 51365 |
| UniProt ID | Q53H76 |
| Refseq Size | 1758 |
| Cytogenetics | 3q13.33 |
| Refseq ORF | 1368 |
| Synonyms | PS-PLA1; PSPLA1 |
| Summary | The protein encoded by this gene is a phospholipase that hydrolyzes fatty acids at the sn-1 position of phosphatidylserine and 1-acyl-2-lysophosphatidylserine. This secreted protein hydrolyzes phosphatidylserine in liposomes. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011] |
| Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Phospholipase A1 Member A Activates Fibroblast-like Synoviocytes through the Autotaxin-Lysophosphatidic Acid Receptor Axis
,null,
International Journal of Molecular Sciences
,PubMed ID 34884486
[PLA1A]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414332 | PLA1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY414332 | Transient overexpression lysate of phospholipase A1 member A (PLA1A) |
CNY 4840.00 |
|
| PH319486 | PLA1A MS Standard C13 and N15-labeled recombinant protein (NP_056984) |
CNY 14250.00 |
