TPD52L2 (NM_199359) Human Recombinant Protein
CAT#: TP319692
Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 6, 20 µg
View other "TPD52L2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219692 representing NM_199359
Red=Cloning site Green=Tags(s) MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAK ERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRN SATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_955391 |
| Locus ID | 7165 |
| UniProt ID | Q68E05 |
| Refseq Size | 2297 |
| Cytogenetics | 20q13.33 |
| Refseq ORF | 559 |
| Synonyms | D54; TPD54 |
| Summary | This gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene may be a marker for breast cancer and acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 12. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401134 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404541 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404543 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401134 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 5 |
CNY 3080.00 |
|
| LY404541 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 6 |
CNY 3080.00 |
|
| LY404543 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 2 |
CNY 3080.00 |
|
| PH301547 | TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_003279) |
CNY 19520.00 |
|
| PH319692 | TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_955391) |
CNY 19520.00 |
|
| TP301547 | Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 5, 20 µg |
CNY 2900.00 |
其它TPD52L2产品
