Acid sphingomyelinase (SMPD1) (NM_000543) Human Recombinant Protein
CAT#: TP319758
Purified recombinant protein of Homo sapiens sphingomyelin phosphodiesterase 1, acid lysosomal (SMPD1), transcript variant 1, 20 µg
View other "Acid sphingomyelinase" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219758 representing NM_000543
Red=Cloning site Green=Tags(s) MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHPLSPQGHP ARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLF EDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLH WDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGD IPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKA WEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTY IGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVY RMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMPDGSLPEAQSLWPRPLF C myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000534 |
| Locus ID | 6609 |
| UniProt ID | P17405 |
| Refseq Size | 2473 |
| Cytogenetics | 11p15.4 |
| Refseq ORF | 1893 |
| Synonyms | ASM; ASMASE; NPD |
| Summary | The protein encoded by this gene is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB). Multiple transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Lysosome, Metabolic pathways, Sphingolipid metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400191 | SMPD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423515 | SMPD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400191 | Transient overexpression lysate of sphingomyelin phosphodiesterase 1, acid lysosomal (SMPD1), transcript variant ASM-1 |
CNY 4840.00 |
|
| LY423515 | Transient overexpression lysate of sphingomyelin phosphodiesterase 1, acid lysosomal (SMPD1), transcript variant ASM-2 |
CNY 4840.00 |
|
| PH319758 | SMPD1 MS Standard C13 and N15-labeled recombinant protein (NP_000534) |
CNY 14250.00 |
其它Acid sphingomyelinase产品
