ADAR1 (ADAR) (NM_001025107) Human Recombinant Protein
CAT#: TP319761
Recombinant protein of human adenosine deaminase, RNA-specific (ADAR), transcript variant 4, 20 µg
View other "ADAR1" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 6281.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219761 protein sequence
Red=Cloning site Green=Tags(s) MAEIKEKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKRERMQI KRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLENRQEARPEPARLKPP VHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPI SGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKA KDSGKSEESSHYSTEKESEKTAESQTPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPK FQYCVAVGAQTFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRK IGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAA DAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTL TNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYS ELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFENP KQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSV TLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYD LEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKD MGYGNWISKPQEEKNFYLCPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 103.5 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001020278 |
| Locus ID | 103 |
| UniProt ID | P55265 |
| Refseq Size | 6532 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 2793 |
| Synonyms | ADAR1; AGS6; DRADA; DSH; DSRAD; G1P1; IFI-4; IFI4; K88DSRBP; P136 |
| Summary | This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double-stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cytosolic DNA-sensing pathway |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
AKT-dependent phosphorylation of the adenosine deaminases ADAR-1 and -2 inhibits deaminase activity
,Bavelloni, A;Focaccia, E;Piazzi, M;Raffini, M;Cesarini, V;Tomaselli, S;Orsini, A;Ratti, S;Faenza, I;Cocco, L;Gallo, A;Blalock, WL;,
FASEB J.
,PubMed ID 31095429
[ADAR]
|
|
The double-domain cytidine deaminase APOBEC3G is a cellular site-specific RNA editing enzyme
,null,
Scientific Reports
,PubMed ID 27974822
[ADAR]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414369 | ADAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420128 | ADAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422591 | ADAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC425483 | ADAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY414369 | Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 3 |
CNY 4840.00 |
|
| LY420128 | Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 1 |
CNY 3080.00 |
|
| LY422591 | Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 4 |
CNY 4840.00 |
|
| LY425483 | Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 4 |
CNY 4840.00 |
|
| PH319761 | ADAR MS Standard C13 and N15-labeled recombinant protein (NP_001020278) |
CNY 19520.00 |
|
| TP762358 | Purified recombinant protein of Human adenosine deaminase, RNA-specific (ADAR), transcript variant 4, Thr30-Gln360, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |

