FAK (PTK2) (NM_153831) Human Recombinant Protein
CAT#: TP319839
Recombinant protein of human PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 1, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219839 representing NM_153831
Red=Cloning site Green=Tags(s) MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQK IVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTED KPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKS LLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGI SYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRL VNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVI TENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCV KLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNND VIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQAT VSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQ TDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKPWRLQPQ EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPA STHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLG QTRPH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 119.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_722560 |
| Locus ID | 5747 |
| UniProt ID | Q05397 |
| Refseq Size | 4453 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 3165 |
| Synonyms | FADK; FADK 1; FAK; FAK1; FRNK; p125FAK; pp125FAK; PPP1R71 |
| Summary | This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Axon guidance, Chemokine signaling pathway, ErbB signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer, VEGF signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Intracellular HMGB1 Negatively Regulates Efferocytosis
,Sami Banerjee, Andressa de Freitas, Arnaud Friggeri, Jaroslaw W. Zmijewski, Gang Liu, and Edward Abraham,
J. Immunol., Nov 2011; 187: 4686 - 4694.
[PTK2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403521 | PTK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC417186 | PTK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC429259 | PTK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403521 | Transient overexpression lysate of PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 1 |
CNY 4840.00 |
|
| LY417186 | Transient overexpression lysate of PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 2 |
CNY 4840.00 |
|
| LY429259 | Transient overexpression lysate of PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 2 |
CNY 4840.00 |
|
| PH319839 | PTK2 MS Standard C13 and N15-labeled recombinant protein (NP_722560) |
CNY 19520.00 |
|
| PH321398 | PTK2 MS Standard C13 and N15-labeled recombinant protein (NP_005598) |
CNY 19520.00 |
|
| TP321398 | Recombinant protein of human PTK2 protein tyrosine kinase 2 (PTK2), transcript variant 2, 20 µg |
CNY 2900.00 |


