NEU2 (NM_005383) Human Recombinant Protein
CAT#: TP319858
Recombinant protein of human sialidase 2 (cytosolic sialidase) (NEU2), 20 µg
View other "NEU2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219858 representing NM_005383
Red=Cloning site Green=Tags(s) MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQA QEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPR DLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGH FVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFP SPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLF GCLYEANDYEEIVFLMFTLKQAFPAEYLPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Cell treatment (PMID: 29118338) |
| Reference Data | |
| RefSeq | NP_005374 |
| Locus ID | 4759 |
| UniProt ID | Q9Y3R4 |
| Refseq Size | 1143 |
| Cytogenetics | 2q37.1 |
| Refseq ORF | 1140 |
| Synonyms | SIAL2 |
| Summary | This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Other glycan degradation, Sphingolipid metabolism |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Attenuated pulmonary fibrosis in sialidase-3 knockout (Neu3−/−) mice
,null,
American Journal of Physiology - Lung Cellular and Molecular Physiology
,PubMed ID 31617733
[NEU2]
|
|
Sialidase inhibitors attenuate pulmonary fibrosis in a mouse model
,Karhadkar, TR;Pilling, D;Cox, N;Gomer, RH;,
Sci Rep
,PubMed ID 29118338
[NEU2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401652 | NEU2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401652 | Transient overexpression lysate of sialidase 2 (cytosolic sialidase) (NEU2) |
CNY 3080.00 |
|
| PH319858 | NEU2 MS Standard C13 and N15-labeled recombinant protein (NP_005374) |
CNY 19520.00 |
|
| TP760824 | Purified recombinant protein of Human sialidase 2 (cytosolic sialidase) (NEU2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |


