LHFPL3 (NM_199000) Human Recombinant Protein
CAT#: TP320013
Recombinant protein of human lipoma HMGIC fusion partner-like 3 (LHFPL3), 20 µg
View other "LHFPL3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220013 protein sequence
Red=Cloning site Green=Tags(s) MPGAAAAAAAAAAAMLPTQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQA GYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKI CAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDALILSFLAFVL GNRQDSLMAEELKAENKVLLSQYSLE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_945351 |
Locus ID | 375612 |
UniProt ID | Q86UP9 |
Refseq Size | 3191 |
Cytogenetics | 7q22.2-q22.3 |
Refseq ORF | 708 |
Synonyms | LHFPL4 |
Summary | This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. A partial gene fragment named LHFPL4 corresponds to a portion of the first exon of this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404712 | LHFPL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404712 | Transient overexpression lysate of lipoma HMGIC fusion partner-like 3 (LHFPL3) |
CNY 3080.00 |
|
PH320013 | LHFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_945351) |
CNY 19520.00 |