IHPK3 (IP6K3) (NM_054111) Human Recombinant Protein
CAT#: TP320137
Recombinant protein of human inositol hexakisphosphate kinase 3 (IP6K3), transcript variant 1, 20 µg
View other "IHPK3" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220137 protein sequence
Red=Cloning site Green=Tags(s) MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKRFTPQYKGTVT VHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQLARSPKESPA KALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQAHLTRLCSEYPENKRHRFLLLENVVSQYTH PCVLDLKMGTRQHGDDASEEKKARHMRKCAQSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGF RQALYQFLHNGSHLRRELLEPILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQ AAHGSSPGGLTKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_473452 |
Locus ID | 117283 |
UniProt ID | Q96PC2 |
Refseq Size | 2711 |
Cytogenetics | 6p21.31 |
Refseq ORF | 1230 |
Synonyms | IHPK3; INSP6K3 |
Summary | This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409286 | IP6K3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428293 | IP6K3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409286 | Transient overexpression lysate of inositol hexakisphosphate kinase 3 (IP6K3), transcript variant 1 |
CNY 3080.00 |
|
LY428293 | Transient overexpression lysate of inositol hexakisphosphate kinase 3 (IP6K3), transcript variant 2 |
CNY 3080.00 |
|
PH320137 | IP6K3 MS Standard C13 and N15-labeled recombinant protein (NP_473452) |
CNY 19520.00 |
|
TP760860 | Purified recombinant protein of Human inositol hexakisphosphate kinase 3 (IP6K3), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |