LGALS9C (NM_001040078) Human Recombinant Protein
CAT#: TP320215
Recombinant protein of human lectin, galactoside-binding, soluble, 9C (LGALS9C), 20 µg
View other "LGALS9C" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220215 protein sequence
Red=Cloning site Green=Tags(s) MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAFHFNPRFEDGG YVVCNTRQKGTWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSV QLSYISFQNPRAVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPIVRPANPAPITQTVIHTVQSASGQMFSQ TPAIPPMMYPHPAYPMPFITTIPGGLYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVR NTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQ LTHVQT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035167 |
Locus ID | 654346 |
UniProt ID | Q6DKI2 |
Refseq Size | 1743 |
Cytogenetics | 17p11.2 |
Refseq ORF | 1068 |
Synonyms | Gal-9B; LGALS9B |
Summary | This gene was initially thought to represent a pseudogene of galectin 9; however, this transcript has good exon-intron structure and encodes a predicted protein of the same size as and highly similar to galectin 9. This gene is one of two similar loci on chromosome 17p similar to galectin 9 and now thought to be protein-encoding. This gene is the more telomeric gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421667 | LGALS9C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421667 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 9C (LGALS9C) |
CNY 3080.00 |
|
PH320215 | LGALS9C MS Standard C13 and N15-labeled recombinant protein (NP_001035167) |
CNY 19520.00 |
其它LGALS9C产品