DGKA (NM_201554) Human Recombinant Protein
CAT#: TP320293
Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4, 20 µg
View other "DGKA" proteins (17)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220293 protein sequence
Red=Cloning site Green=Tags(s) MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 82.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_963848 |
Locus ID | 1606 |
UniProt ID | P23743 |
Refseq Size | 2669 |
Cytogenetics | 12q13.2 |
Refseq ORF | 2205 |
Synonyms | DAGK; DAGK1; DGK-alpha |
Summary | The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Apr 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400535 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404426 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404427 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC404458 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430856 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400535 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3 |
CNY 3080.00 |
|
LY404426 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 |
CNY 3080.00 |
|
LY404427 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2 |
CNY 4840.00 |
|
LY404458 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4 |
CNY 3080.00 |
|
LY430856 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 |
CNY 4840.00 |
|
PH302930 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958852) |
CNY 19520.00 |
|
PH318968 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958853) |
CNY 19520.00 |
|
PH320293 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_963848) |
CNY 19520.00 |
|
PH322395 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_001336) |
CNY 14250.00 |
|
TP302930 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP318968 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP322395 | Purified recombinant protein of Homo sapiens diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3, 20 µg |
CNY 2900.00 |