OCIAD1 (NM_001079842) Human Recombinant Protein
CAT#: TP320792
Purified recombinant protein of Homo sapiens OCIA domain containing 1 (OCIAD1), transcript variant 5, 20 µg
View other "OCIAD1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220792 representing NM_001079842
Red=Cloning site Green=Tags(s) MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGRNFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001073311 |
| Locus ID | 54940 |
| UniProt ID | Q9NX40 |
| Refseq Size | 1754 |
| Cytogenetics | 4p11 |
| Refseq ORF | 561 |
| Synonyms | ASRIJ; OCIA; TPA018 |
| Summary | Maintains stem cell potency (By similarity). Increases STAT3 phosphorylation and controls ERK phosphorylation (By similarity). May act as a scaffold, increasing STAT3 recruitment onto endosomes (By similarity). Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer (PubMed:20515946).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402620 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421553 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421556 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402620 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 1 |
CNY 3080.00 |
|
| LY421553 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 2 |
CNY 3080.00 |
|
| LY421556 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 5 |
CNY 3080.00 |
|
| PH301506 | OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_060300) |
CNY 19520.00 |
|
| PH320792 | OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) |
CNY 14250.00 |
|
| TP301506 | Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1, 20 µg |
CNY 2900.00 |
