KATNAL1 (NM_001014380) Human Recombinant Protein
CAT＃: TP320944
Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2, 20 µg
View other "KATNAL1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
CNY 1999.00
CNY 2700.00
热销推荐Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220944 protein sequence
Red=Cloning site Green=Tags(s) MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELLEEYEQVKSIV STLESFKIDKPPDFPVSCQDEPFRDPAVWPPPVPAEHRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAH PISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDI ADLEEAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSK YRGESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSK MVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDPDIQLEDIAEKIEGYSGADI TNVCRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFGSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001014402 |
| Locus ID | 84056 |
| UniProt ID | Q9BW62 |
| Refseq Size | 7512 |
| Cytogenetics | 13q12.3 |
| Refseq ORF | 1470 |
| Summary | Regulates microtubule dynamics in Sertoli cells, a process that is essential for spermiogenesis and male fertility. Severs microtubules in an ATP-dependent manner, promoting rapid reorganization of cellular microtubule arrays (By similarity). Has microtubule-severing activity in vitro (PubMed:26929214).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403145 | KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423055 | KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403145 | Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1 |
CNY 3080.00 |
|
| LY423055 | Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2 |
CNY 4840.00 |
|
| PH300828 | KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_115492) |
CNY 19520.00 |
|
| PH320944 | KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_001014402) |
CNY 19520.00 |
|
| TP300828 | Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它KATNAL1产品
