VCX3A (NM_016379) Human Recombinant Protein
CAT#: TP321002L
Recombinant protein of human variable charge, X-linked 3A (VCX3A), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
货期*
4周
规格
推荐一起购买 (3)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221002 protein sequence
Red=Cloning site Green=Tags(s) MSPKPRASGPPAKAREAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPPSQESQLEEPLSQESEVEEPLSQESQVEEPLSQESEV EEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057463 |
Locus ID | 51481 |
UniProt ID | Q9NNX9 |
Refseq Size | 1004 |
Cytogenetics | Xp22.31 |
Refseq ORF | 558 |
Synonyms | VCX-8r; VCX-A; VCX3; VCX8R; VCXA |
Summary | This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...