ZDHHC15 (NM_144969) Human Recombinant Protein
CAT#: TP321105
Recombinant protein of human zinc finger, DHHC-type containing 15 (ZDHHC15), 20 µg
View other "ZDHHC15" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC221105 representing NM_144969 
Red=Cloning site Green=Tags(s) MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTW TYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPD RCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSK FHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKF WLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 39.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_659406 | 
| Locus ID | 158866 | 
| UniProt ID | Q96MV8 | 
| Refseq Size | 1782 | 
| Cytogenetics | Xq13.3 | 
| Refseq ORF | 1011 | 
| Synonyms | DHHC15; MRX91 | 
| Summary | The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] | 
| Protein Families | Transmembrane | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Calponin-h2: a potential serum marker for the early detection of human breast cancer?
                                                ,null,
                                                Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine
                                                ,PubMed ID 25099617
                                                [ZDHHC15]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC403407 | ZDHHC15 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC431287 | ZDHHC15 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY403407 | Transient overexpression lysate of zinc finger, DHHC-type containing 15 (ZDHHC15), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY431287 | Transient overexpression lysate of zinc finger, DHHC-type containing 15 (ZDHHC15), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| PH321105 | ZDHHC15 MS Standard C13 and N15-labeled recombinant protein (NP_659406) | 
                                                     CNY 19520.00  | 
                                            
其它ZDHHC15产品
