SEC14L4 (NM_174977) Human Recombinant Protein
CAT#: TP321251
Recombinant protein of human SEC14-like 4 (S. cerevisiae) (SEC14L4), 20 µg
View other "SEC14L4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221251 representing NM_174977
Red=Cloning site Green=Tags(s) MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDN IVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQ KLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMS EETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEH TRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPED GSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_777637 |
| Locus ID | 284904 |
| UniProt ID | Q9UDX3 |
| Refseq Size | 2499 |
| Cytogenetics | 22q12.2 |
| Refseq ORF | 1218 |
| Synonyms | TAP3 |
| Summary | The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406368 | SEC14L4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431871 | SEC14L4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406368 | Transient overexpression lysate of SEC14-like 4 (S. cerevisiae) (SEC14L4), transcript variant 1 |
CNY 3080.00 |
|
| LY431871 | Transient overexpression lysate of SEC14-like 4 (S. cerevisiae) (SEC14L4), transcript variant 2 |
CNY 3080.00 |
|
| PH321251 | SEC14L4 MS Standard C13 and N15-labeled recombinant protein (NP_777637) |
CNY 19520.00 |
其它SEC14L4产品
