LRRC55 (NM_001005210) Human Recombinant Protein
CAT#: TP321563
Recombinant protein of human leucine rich repeat containing 55 (LRRC55), 20 µg
View other "LRRC55" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221563 representing NM_001005210
Red=Cloning site Green=Tags(s) MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAA GLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLH NNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDL DLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAP LFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001005210 |
| Locus ID | 219527 |
| UniProt ID | Q6ZSA7 |
| Refseq Size | 3797 |
| Cytogenetics | 11q12.1 |
| Refseq ORF | 1023 |
| Summary | Auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). Modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction, and in the absence of calcium.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423802 | LRRC55 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423802 | Transient overexpression lysate of leucine rich repeat containing 55 (LRRC55) |
CNY 3080.00 |
|
| PH321563 | LRRC55 MS Standard C13 and N15-labeled recombinant protein (NP_001005210) |
CNY 19520.00 |
