CLEC2D (NM_001004419) Human Recombinant Protein
CAT#: TP321680
Recombinant protein of human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2, 20 µg
View other "CLEC2D" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221680 representing NM_001004419
Red=Cloning site Green=Tags(s) MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG QPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.1 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001004419 |
| Locus ID | 29121 |
| UniProt ID | Q9UHP7 |
| Refseq Size | 1821 |
| Cytogenetics | 12p13.31 |
| Refseq ORF | 582 |
| Synonyms | CLAX; LLT1; OCIL |
| Summary | This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415703 | CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423748 | CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433996 | CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415703 | Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 1 |
CNY 3080.00 |
|
| LY423748 | Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 2 |
CNY 3080.00 |
|
| LY433996 | Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 3 |
CNY 3080.00 |
|
| PH321680 | CLEC2D MS Standard C13 and N15-labeled recombinant protein (NP_001004419) |
CNY 19520.00 |
