HEPACAM2 (NM_001039372) Human Recombinant Protein
CAT#: TP321826
Recombinant protein of human HEPACAM family member 2 (HEPACAM2), transcript variant 1, 20 µg
View other "HEPACAM2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221826 representing NM_001039372
Red=Cloning site Green=Tags(s) MGQDAFMEPFGDTLGVFQCKIYLLLFGACSGLKVTVPSHTVHGVRGQALYLPVHYGFHTPASDIQIIWLF ERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLSASQKIQV TVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAYQWLKNGRPVHTSSTYSFSPQNNTLHIAPVT KEDIGNYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTY SWIRRTDNTTYIIKHGPRLEVASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLS PLASITGISLFLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDV SGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001034461 |
| Locus ID | 253012 |
| UniProt ID | A8MVW5 |
| Refseq Size | 2092 |
| Cytogenetics | 7q21.2 |
| Refseq ORF | 1386 |
| Synonyms | MIKI |
| Summary | This gene encodes a protein related to the immunoglobulin superfamily that plays a role in mitosis. Knockdown of this gene results in prometaphase arrest, abnormal nuclear morphology and apoptosis. Poly(ADP-ribosylation) of the encoded protein promotes its translocation to centrosomes, which may stimulate centrosome maturation. A chromosomal deletion including this gene may be associated with myeloid leukemia and myelodysplastic syndrome in human patients. [provided by RefSeq, Oct 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422040 | HEPACAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY422040 | Transient overexpression lysate of HEPACAM family member 2 (HEPACAM2), transcript variant 1 |
CNY 4840.00 |
|
| PH321826 | HEPACAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001034461) |
CNY 14250.00 |
其它HEPACAM2产品
