CKII alpha (CSNK2A1) (NM_001895) Human Recombinant Protein
CAT#: TP322302
Recombinant protein of human casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2, 20 µg
View other "CKII alpha" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222302 representing NM_001895
Red=Cloning site Green=Tags(s) MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL KPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEI LKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYD YSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKR WERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN MMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001886 |
Locus ID | 1457 |
UniProt ID | P68400 |
Refseq Size | 2732 |
Cytogenetics | 20p13 |
Refseq ORF | 1173 |
Synonyms | CK2A1; Cka1; Cka2; CKII; OCNDS |
Summary | Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythm. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. Multiple transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Apr 2018] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase |
Protein Pathways | Adherens junction, Tight junction, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419673 | CSNK2A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419673 | Transient overexpression lysate of casein kinase 2, alpha 1 polypeptide (CSNK2A1), transcript variant 2 |
CNY 3080.00 |
|
PH322302 | CSNK2A1 MS Standard C13 and N15-labeled recombinant protein (NP_001886) |
CNY 19520.00 |
|
TP760181 | Recombinant protein of human casein kinase 2, alpha 1 polypeptide (CSNK2A1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它CKII alpha产品