Myelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Recombinant Protein
CAT#: TP322455M
Recombinant protein of human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1, 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222455 representing NM_206809
Red=Cloning site Green=Tags(s) MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.1 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_996532 |
| Locus ID | 4340 |
| UniProt ID | Q16653 |
| Refseq Size | 2119 |
| Cytogenetics | 6p22.1 |
| Refseq ORF | 741 |
| Synonyms | BTN6; BTNL11; MOGIG2; NRCLP7 |
| Summary | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
其它Myelin oligodendrocyte glycoprotein产品
