FSH beta (FSHB) (NM_000510) Human Recombinant Protein
CAT#: TP322666
Recombinant protein of human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 1, 20 µg
View other "FSH beta" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222666 protein sequence
Red=Cloning site Green=Tags(s) MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000501 |
| Locus ID | 2488 |
| UniProt ID | P01225 |
| Refseq Size | 1936 |
| Cytogenetics | 11p14.1 |
| Refseq ORF | 387 |
| Synonyms | HH24 |
| Summary | The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | GnRH signaling pathway, Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400397 | FSHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424668 | FSHB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400397 | Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2 |
CNY 3080.00 |
|
| LY424668 | Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 1 |
CNY 3080.00 |
|
| PH314616 | FSHB MS Standard C13 and N15-labeled recombinant protein (NP_001018090) |
CNY 19520.00 |
|
| PH322666 | FSHB MS Standard C13 and N15-labeled recombinant protein (NP_000501) |
CNY 19520.00 |
|
| TP314616 | Recombinant protein of human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP701085 | Purified recombinant protein of Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, Asn19-end, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
其它FSH beta产品
