RHOF (NM_019034) Human Recombinant Protein
CAT#: TP322772
Purified recombinant protein of Homo sapiens ras homolog gene family, member F (in filopodia) (RHOF), 20 µg
View other "RHOF" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222772 representing NM_019034
Red=Cloning site Green=Tags(s) MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLN LYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKE QLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLL L myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061907 |
Locus ID | 54509 |
UniProt ID | Q9HBH0 |
Refseq Size | 2451 |
Cytogenetics | 12q24.31 |
Refseq ORF | 633 |
Synonyms | ARHF; RIF |
Summary | Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412802 | RHOF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412802 | Transient overexpression lysate of ras homolog gene family, member F (in filopodia) (RHOF) |
CNY 3080.00 |
|
PH322772 | RHOF MS Standard C13 and N15-labeled recombinant protein (NP_061907) |
CNY 14250.00 |