SEC13L1 (SEC13) (NM_183352) Human Recombinant Protein
CAT#: TP322811
Recombinant protein of human SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1, 20 µg
View other "SEC13L1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222811 protein sequence
Red=Cloning site Green=Tags(s) MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_899195 |
Locus ID | 6396 |
UniProt ID | P55735 |
Refseq Size | 1437 |
Cytogenetics | 3p25.3 |
Refseq ORF | 966 |
Synonyms | D3S1231E; npp-20; SEC13L1; SEC13R |
Summary | The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405245 | SEC13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427864 | SEC13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405245 | Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1 |
CNY 3080.00 |
|
LY427864 | Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 2 |
CNY 3080.00 |
|
PH322811 | SEC13 MS Standard C13 and N15-labeled recombinant protein (NP_899195) |
CNY 19520.00 |
其它SEC13L1产品