ARHGAP9 (NM_001080156) Human Recombinant Protein
CAT#: TP322813
Recombinant protein of human Rho GTPase activating protein 9 (ARHGAP9), transcript variant 3, 20 µg
View other "ARHGAP9" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222813 representing NM_001080156
Red=Cloning site Green=Tags(s) MSEPPVYCNLVDLRRCPRSPPPGPACPLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNP GSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVE KSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGR HLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLDRENPLELRLSGSGPAELSAGEDEEEE SELVSKPLLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGD TVPSFLRLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTE WDDIHVVTGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLC RVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTNFTSLFP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 61 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001073625 |
| Locus ID | 64333 |
| UniProt ID | Q9BRR9 |
| Refseq Size | 2102 |
| Cytogenetics | 12q13.3 |
| Refseq ORF | 1641 |
| Synonyms | 10C; RGL1 |
| Summary | This gene encodes a member of the Rho-GAP family of GTPase activating proteins. The protein has substantial GAP activity towards several Rho-family GTPases in vitro, converting them to an inactive GDP-bound state. It is implicated in regulating adhesion of hematopoietic cells to the extracellular matrix. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421603 | ARHGAP9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421604 | ARHGAP9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY421603 | Transient overexpression lysate of Rho GTPase activating protein 9 (ARHGAP9), transcript variant 3 |
CNY 4840.00 |
|
| LY421604 | Transient overexpression lysate of Rho GTPase activating protein 9 (ARHGAP9), transcript variant 2 |
CNY 4840.00 |
|
| PH322813 | ARHGAP9 MS Standard C13 and N15-labeled recombinant protein (NP_001073625) |
CNY 19520.00 |
其它ARHGAP9产品
