WFDC3 (NM_080614) Human Recombinant Protein
CAT#: TP322831
Recombinant protein of human WAP four-disulfide core domain 3 (WFDC3), 20 µg
View other "WFDC3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222831 representing NM_080614
Red=Cloning site Green=Tags(s) MMLSCLFLLKALLALGSLESWITAGEHAKEGECPPDKNPCKELCQGDELCPAEQKCCTTGCGRICRDIPK GRKRDCPRVIRKQSCLKRCITDKTCPGVKKCCTLGCNKSCVVPISKQKLAEFGGECPADPLPCEELCDGD ASCPQGHKCCSTGCGRTCLGDIEGGRGGDCPKVLVGLCIVGCVMDENCQAGEKCCKSGCGRFCVPPVLPP KLTMNPNWTVRSDSELEIPVP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542181 |
Locus ID | 140686 |
UniProt ID | Q8IUB2 |
Refseq Size | 1000 |
Cytogenetics | 20q13.12 |
Refseq ORF | 693 |
Synonyms | dJ447F3.3; WAP14 |
Summary | This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409156 | WFDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409156 | Transient overexpression lysate of WAP four-disulfide core domain 3 (WFDC3) |
CNY 3080.00 |
|
PH322831 | WFDC3 MS Standard C13 and N15-labeled recombinant protein (NP_542181) |
CNY 19520.00 |