Sprouty 1 (SPRY1) (NM_199327) Human Recombinant Protein
CAT#: TP322860
Purified recombinant protein of Homo sapiens sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 2, 20 µg
View other "Sprouty 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222860 protein sequence
Red=Cloning site Green=Tags(s) MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSP PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLC SAESMVEYGTCMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCL KLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_955359 |
Locus ID | 10252 |
UniProt ID | O43609 |
Refseq Size | 2380 |
Cytogenetics | 4q28.1 |
Refseq ORF | 957 |
Synonyms | hSPRY1 |
Summary | May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401771 | SPRY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404622 | SPRY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401771 | Transient overexpression lysate of sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 1 |
CNY 3080.00 |
|
LY404622 | Transient overexpression lysate of sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 2 |
CNY 3080.00 |
|
PH322860 | SPRY1 MS Standard C13 and N15-labeled recombinant protein (NP_955359) |
CNY 14250.00 |
其它Sprouty 1产品