SKA3 (NM_145061) Human Recombinant Protein
CAT#: TP322931
Recombinant protein of human chromosome 13 open reading frame 3 (C13orf3), 20 µg
View other "SKA3" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222931 representing NM_145061
Red=Cloning site Green=Tags(s) MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNILLDKARLENQ EGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSDPELSNCENFQKTDVKDDLSD PPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVNNYKEEPVIVTPPTKQSLVKVLKTPKCALKM DDFECVTPKLEHFGISEYTMCLNEDYTMGLKNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEY TNSPLVPTFCTPGLKIPSTKNSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTIS SYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659498 |
Locus ID | 221150 |
UniProt ID | Q8IX90 |
Refseq Size | 2907 |
Cytogenetics | 13q12.11 |
Refseq ORF | 1236 |
Synonyms | C13orf3; RAMA1 |
Summary | This gene encodes a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408058 | SKA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431342 | SKA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408058 | Transient overexpression lysate of spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 1 |
CNY 3080.00 |
|
LY431342 | Transient overexpression lysate of spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 2 |
CNY 3080.00 |
|
PH322931 | SKA3 MS Standard C13 and N15-labeled recombinant protein (NP_659498) |
CNY 19520.00 |
|
TP328314 | Recombinant protein of human spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 2, 20 µg |
CNY 2900.00 |