DHPS (NM_013407) Human Recombinant Protein
CAT#: TP322934
Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 3, 20 µg
View other "DHPS" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222934 representing NM_013407
Red=Cloning site Green=Tags(s) MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEGARPDEAVSWGKIRVDAQP VKVYADASLVFPLLVAETFAQKMDAFMHEKNED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037539 |
Locus ID | 1725 |
UniProt ID | P49366 |
Refseq Size | 1183 |
Cytogenetics | 19p13.13 |
Refseq ORF | 939 |
Synonyms | DHS; MIG13 |
Summary | This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400714 | DHPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415606 | DHPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400714 | Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 1 |
CNY 3080.00 |
|
LY415606 | Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 3 |
CNY 3080.00 |
|
PH304235 | DHPS MS Standard C13 and N15-labeled recombinant protein (NP_001921) |
CNY 19520.00 |
|
PH322934 | DHPS MS Standard C13 and N15-labeled recombinant protein (NP_037539) |
CNY 19520.00 |
|
TP304235 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720110 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1 |
CNY 1800.00 |