TRAF4AF1 (KNSTRN) (NM_033286) Human Recombinant Protein
CAT#: TP322981L
Recombinant protein of human chromosome 15 open reading frame 23 (C15orf23), transcript variant 1, 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222981 protein sequence
Red=Cloning site Green=Tags(s) MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQEADLAGGTTVAAGNLLNESEKDCGQDRRAPG VQPCLLVTMTSVVKTVYSLQPSSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITK LRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELL EKFRDNCLAILESKGLDPALGGETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKL EMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_150628 |
| Locus ID | 90417 |
| UniProt ID | Q9Y448 |
| Refseq Size | 1763 |
| Cytogenetics | 15q15.1 |
| Refseq ORF | 948 |
| Synonyms | C15orf23; HSD11; SKAP; TRAF4AF1 |
| Summary | Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase (PubMed:19667759). Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture (PubMed:19667759, PubMed:22110139). The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments (PubMed:21402792). Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division (PubMed:23035123). May be involved in UV-induced apoptosis via its interaction with PRPF19; however, these results need additional evidences (PubMed:24718257).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它TRAF4AF1产品
