C9orf23 (RPP25L) (NM_148179) Human Recombinant Protein
CAT#: TP323396
Recombinant protein of human chromosome 9 open reading frame 23 (C9orf23), transcript variant 2, 20 µg
View other "C9orf23" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223396 protein sequence
Red=Cloning site Green=Tags(s) MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSC AEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPP GLGSMPSSSCGPRSRRRARDTRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_680545 |
| Locus ID | 138716 |
| UniProt ID | Q8N5L8 |
| Refseq Size | 1119 |
| Cytogenetics | 9p13.3 |
| Refseq ORF | 489 |
| Synonyms | bA296L22.5; C9orf23 |
| Summary | This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407738 | RPP25L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407739 | RPP25L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407738 | Transient overexpression lysate of chromosome 9 open reading frame 23 (C9orf23), transcript variant 1 |
CNY 3080.00 |
|
| LY407739 | Transient overexpression lysate of chromosome 9 open reading frame 23 (C9orf23), transcript variant 2 |
CNY 3080.00 |
|
| PH305700 | C9orf23 MS Standard C13 and N15-labeled recombinant protein (NP_680544) |
CNY 19520.00 |
|
| PH323396 | C9orf23 MS Standard C13 and N15-labeled recombinant protein (NP_680545) |
CNY 19520.00 |
|
| TP305700 | Recombinant protein of human chromosome 9 open reading frame 23 (C9orf23), transcript variant 1, 20 µg |
CNY 2900.00 |
其它C9orf23产品
