GDPD1 (NM_182569) Human Recombinant Protein
CAT#: TP323431
Recombinant protein of human glycerophosphodiester phosphodiesterase domain containing 1 (GDPD1), 20 µg
View other "GDPD1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223431 representing NM_182569
Red=Cloning site Green=Tags(s) MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDT LELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSFQRACQCEGKDNRIPLLKEVF EAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILG LFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVL NEEQEYKRAFDLGATGVMTDYPTKLRDFLHNFSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872375 |
Locus ID | 284161 |
UniProt ID | Q8N9F7 |
Refseq Size | 1822 |
Cytogenetics | 17q22 |
Refseq ORF | 942 |
Synonyms | GDE4 |
Summary | This gene encodes a member of the glycerophosphodiester phosphodiesterase family of enzymes that catalyze the hydrolysis of deacylated glycerophospholipids to glycerol phosphate and alcohol. The encoded protein is localized to the cytoplasm and concentrates near the perinuclear region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405490 | GDPD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405490 | Transient overexpression lysate of glycerophosphodiester phosphodiesterase domain containing 1 (GDPD1), transcript variant 1 |
CNY 3080.00 |
|
PH323431 | GDPD1 MS Standard C13 and N15-labeled recombinant protein (NP_872375) |
CNY 19520.00 |