GPLD1 (NM_177483) Human Recombinant Protein
CAT#: TP323455
Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2, 20 µg
View other "GPLD1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223455 representing NM_177483
Red=Cloning site Green=Tags(s) MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG FLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_803436 |
Locus ID | 2822 |
UniProt ID | P80108 |
Refseq Size | 1096 |
Cytogenetics | 6p22.3 |
Refseq ORF | 528 |
Synonyms | GPIPLD; GPIPLDM; MGC22590; PIGPLD; PIGPLD1 |
Summary | Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406093 | GPLD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419906 | GPLD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY406093 | Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 2 |
CNY 3080.00 |
|
LY419906 | Transient overexpression lysate of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 1 |
CNY 4840.00 |
|
PH317578 | GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_001494) |
CNY 19520.00 |
|
PH323455 | GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_803436) |
CNY 19520.00 |
|
TP317578 | Recombinant protein of human glycosylphosphatidylinositol specific phospholipase D1 (GPLD1), transcript variant 1, 20 µg |
CNY 2900.00 |