ketohexokinase (KHK) (NM_006488) Human Recombinant Protein
CAT#: TP323488L
Recombinant protein of human ketohexokinase (fructokinase) (KHK), transcript variant b, 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223488 representing NM_006488
Red=Cloning site Green=Tags(s) MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVAD FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEG RNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRF GCQVAGKKCGLQGFDGIV SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 32.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006479 |
| Locus ID | 3795 |
| UniProt ID | P50053 |
| Refseq Size | 1899 |
| Cytogenetics | 2p23.3 |
| Refseq ORF | 894 |
| Summary | This gene encodes ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Fructose and mannose metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
其它ketohexokinase产品
