NOR1 (NR4A3) (NM_173200) Human Recombinant Protein
CAT#: TP323629
Recombinant protein of human nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 3, 20 µg
View other "NOR1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223629 representing NM_173200
Red=Cloning site Green=Tags(s) MHDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIS TFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLP STSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPH PPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASS LLGESPSLPSPPSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKR RRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDS TPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFV LRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGL KEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKL FLDTLPF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775292 |
Locus ID | 8013 |
UniProt ID | Q92570 |
Refseq Size | 4983 |
Cytogenetics | 9q31.1 |
Refseq ORF | 1911 |
Synonyms | CHN; CSMF; MINOR; NOR1 |
Summary | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406643 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC416280 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC429326 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406643 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 2 |
CNY 4840.00 |
|
LY416280 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 |
CNY 4840.00 |
|
LY429326 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 |
CNY 3080.00 |
|
PH323629 | NR4A3 MS Standard C13 and N15-labeled recombinant protein (NP_775292) |
CNY 19520.00 |