Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Recombinant Protein
CAT＃: TP323658
Recombinant protein of human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 4, 20 µg
View other "Deoxyribonuclease I like 1" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223658 protein sequence
Red=Cloning site Green=Tags(s) MHYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVDSSGSAIPLLL RELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYNDEDDVFAREPFVAQFSLPSNVLP SLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILLGDFNADCASLTKKRLDKLELRTEPGFHWVI ADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDHYPVEVELKLSQAHSV QPLSLTVLLLLSLLSPQLCPAA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001009934 |
| Locus ID | 1774 |
| UniProt ID | P49184 |
| Refseq Size | 2665 |
| Cytogenetics | Xq28 |
| Refseq ORF | 906 |
| Synonyms | DNAS1L1; DNASEX; DNL1L; G4.8; XIB |
| Summary | This gene encodes a deoxyribonuclease protein that shows high sequence similarity to DNase I. The encoded protein is localized to the endoplasmic reticulum and modified by N-linked glycosylation. Alternate transcriptional splice variants encoding the same protein have been observed. [provided by RefSeq, Jan 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402010 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423155 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423156 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423157 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402010 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 1 |
CNY 3080.00 |
|
| LY423155 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2 |
CNY 3080.00 |
|
| LY423156 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 3 |
CNY 3080.00 |
|
| LY423157 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 4 |
CNY 3080.00 |
|
| PH323658 | DNASE1L1 MS Standard C13 and N15-labeled recombinant protein (NP_001009934) |
CNY 19520.00 |
|
| TP760294 | Recombinant protein of human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760968 | Purified recombinant protein of Human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
|
| TP761603 | Purified recombinant protein of Human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Deoxyribonuclease I like 1产品
