PRR20A (NM_198441) Human Recombinant Protein
CAT#: TP323756
Recombinant protein of human proline rich 20 (PRR20), 20 µg
View other "PRR20A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223756 protein sequence
Red=Cloning site Green=Tags(s) MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPP PAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSE TGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQ GVPVFLTDIAY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_940843 |
| Locus ID | 122183 |
| UniProt ID | P86496 |
| Refseq Size | 1847 |
| Cytogenetics | 13q21.1 |
| Refseq ORF | 663 |
| Synonyms | PRR20; PRR20B; PRR20C; PRR20D; PRR20E |
| Summary | This gene is one of five identical loci in a cluster on chromosome 13q21.1. The predicted protein is proline-rich and contains several dopamine D4 receptor signatures and PRINTS domains. [provided by RefSeq, Oct 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
