alpha Adducin (ADD1) (NM_001119) Human Recombinant Protein
CAT＃: TP323881
Recombinant protein of human adducin 1 (alpha) (ADD1), transcript variant 1, 20 µg
View other "alpha Adducin" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223881 representing NM_001119
Red=Cloning site Green=Tags(s) MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSMILQSPAFCEE LESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDK GEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRG STNLGVNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDE EEKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYK AKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYS FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFV PLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTG PNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLEEDLVPEPTTGD DSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAPSAVEEG AAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 80.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001110 |
| Locus ID | 118 |
| UniProt ID | P35611 |
| Refseq Size | 3970 |
| Cytogenetics | 4p16.3 |
| Refseq ORF | 2211 |
| Synonyms | ADDA |
| Summary | Adducins are a family of cytoskeletal proteins encoded by three genes (alpha, beta, and gamma). Adducin acts as a heterodimer of the related alpha, beta, or gamma subunits. The protein encoded by this gene represents the alpha subunit. Alpha- and beta-adducin include a protease-resistant N-terminal region and a protease-sensitive, hydrophilic C-terminal region. Adducin binds with high affinity to Ca(2+)/calmodulin and is a substrate for protein kinases A and C. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406127 | ADD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415438 | ADD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420118 | ADD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY406127 | Transient overexpression lysate of adducin 1 (alpha) (ADD1), transcript variant 4 |
CNY 3080.00 |
|
| LY415438 | Transient overexpression lysate of adducin 1 (alpha) (ADD1), transcript variant 3 |
CNY 4840.00 |
|
| LY420118 | Transient overexpression lysate of adducin 1 (alpha) (ADD1), transcript variant 1 |
CNY 4840.00 |
|
| PH323881 | ADD1 MS Standard C13 and N15-labeled recombinant protein (NP_001110) |
CNY 19520.00 |
其它alpha Adducin产品
