CGGBP1 (NM_001008390) Human Recombinant Protein
CAT#: TP323883
Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1, 20 µg
View other "CGGBP1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223883 protein sequence
Red=Cloning site Green=Tags(s) MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI PKSDQLRRAYLPDGYENENQLLNSQDC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001008391 |
| Locus ID | 8545 |
| UniProt ID | Q9UFW8 |
| Refseq Size | 4608 |
| Cytogenetics | 3p11.1 |
| Refseq ORF | 501 |
| Synonyms | CGGBP; p20-CGGBP |
| Summary | This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences. [provided by RefSeq, Jul 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418512 | CGGBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423417 | CGGBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418512 | Transient overexpression lysate of CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2 |
CNY 3080.00 |
|
| LY423417 | Transient overexpression lysate of CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1 |
CNY 3080.00 |
|
| PH308653 | CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003654) |
CNY 19520.00 |
|
| PH323883 | CGGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001008391) |
CNY 19520.00 |
|
| TP308653 | Recombinant protein of human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2, 20 µg |
CNY 2900.00 |

