OIF (OGN) (NM_033014) Human Recombinant Protein
CAT#: TP323948
Recombinant protein of human osteoglycin (OGN), transcript variant 1, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223948 representing NM_033014
Red=Cloning site Green=Tags(s) MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG KHPNSFICLKRLPIGSYF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_148935 |
Locus ID | 4969 |
UniProt ID | P20774 |
Refseq Size | 2976 |
Cytogenetics | 9q22.31 |
Refseq ORF | 894 |
Synonyms | OG; OIF; SLRR3A |
Summary | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Secreted Protein |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Osteoglycin prevents the development of age-related diastolic dysfunction during pressure overload by reducing cardiac fibrosis and inflammation.
,null,
Matrix biology : journal of the International Society for Matrix Biology
,PubMed ID 28958774
[OGN]
|
Transforming Growth Factor-β3 Regulates Adipocyte Number in Subcutaneous White Adipose Tissue
,Petrus, P;Mejhert, N;Corrales, P;Lecoutre, S;Li, Q;Maldonado, E;Kulyté, A;Lopez, Y;Campbell, M;Acosta, JR;Laurencikiene, J;Douagi, I;Gao, H;Martínez-Álvarez, C;Hedén, P;Spalding, KL;Vidal-Puig, A;Medina-Gomez, G;Arner, P;Rydén, M;,
Cell Rep
,PubMed ID 30332637
[OGN]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403216 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411273 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415500 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403216 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 1 |
CNY 3080.00 |
|
LY411273 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 2 |
CNY 3080.00 |
|
LY415500 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 3 |
CNY 3080.00 |
|
PH310651 | OGN MS Standard C13 and N15-labeled recombinant protein (NP_054776) |
CNY 19520.00 |
|
PH323948 | OGN MS Standard C13 and N15-labeled recombinant protein (NP_148935) |
CNY 19520.00 |
|
TP310651 | Recombinant protein of human osteoglycin (OGN), transcript variant 3, 20 µg |
CNY 2900.00 |