Caldesmon (CALD1) (NM_033157) Human Recombinant Protein
CAT#: TP323989
Recombinant protein of human caldesmon 1 (CALD1), transcript variant 3, 20 µg
View other "Caldesmon" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223989 representing NM_033157
Red=Cloning site Green=Tags(s) MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNA QNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQND TAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQGEE KGTKVQAKREKLQEDKPTFKKEEIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENT FSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVL EEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEER AEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKG NVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTS PTKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_149347 |
| Locus ID | 800 |
| UniProt ID | Q05682 |
| Refseq Size | 4546 |
| Cytogenetics | 7q33 |
| Refseq ORF | 1692 |
| Synonyms | CDM; H-CAD; HCAD; L-CAD; LCAD; NAG22 |
| Summary | This gene encodes a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409704 | CALD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC409713 | CALD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY409704 | Transient overexpression lysate of caldesmon 1 (CALD1), transcript variant 4 |
CNY 4840.00 |
|
| LY409713 | Transient overexpression lysate of caldesmon 1 (CALD1), transcript variant 3 |
CNY 4840.00 |
|
| PH323989 | CALD1 MS Standard C13 and N15-labeled recombinant protein (NP_149347) |
CNY 19520.00 |
其它Caldesmon产品
