EFCBP2 (NECAB2) (NM_019065) Human Recombinant Protein
CAT#: TP324047
Recombinant protein of human N-terminal EF-hand calcium binding protein 2 (NECAB2), 20 µg
View other "EFCBP2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224047 representing NM_019065
Red=Cloning site Green=Tags(s) MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRGGTAVILDIFR RADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETL NHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQLRQNHIKPSHSAA QTWCGSPTPASAPNHKLMAMEQGKTLPSATEDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDG TNMHLQLVRQEMAVCPEQLSEFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQ SPLCKAFRHVKVDTLSQPEALSRILVPAAWCTVGRD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_061938 |
| Locus ID | 54550 |
| UniProt ID | Q7Z6G3 |
| Refseq Size | 1636 |
| Cytogenetics | 16q23.3 |
| Refseq ORF | 1158 |
| Synonyms | EFCBP2; stip-2 |
| Summary | The protein encoded by this gene is a neuronal calcium-binding protein that binds to and modulates the function of at least two receptors, adenosine A(2A) receptor and metabotropic glutamate receptor type 5. [provided by RefSeq, Jul 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412778 | NECAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412778 | Transient overexpression lysate of N-terminal EF-hand calcium binding protein 2 (NECAB2) |
CNY 3080.00 |
|
| PH324047 | NECAB2 MS Standard C13 and N15-labeled recombinant protein (NP_061938) |
CNY 19520.00 |
