PD L2 (PDCD1LG2) (NM_025239) Human Recombinant Protein
CAT#: TP324141L
Recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224141 representing NM_025239
Red=Cloning site Green=Tags(s) MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079515 |
| Locus ID | 80380 |
| UniProt ID | Q9BQ51 |
| Refseq Size | 1518 |
| Cytogenetics | 9p24.1 |
| Refseq ORF | 819 |
| Synonyms | B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2 |
| Summary | Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
| FAQs |
| SDS |
