CARS1 (NM_139273) Human Recombinant Protein
CAT#: TP324149
Recombinant protein of human cysteinyl-tRNA synthetase (CARS), transcript variant 1, 20 µg
View other "CARS1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224149 representing NM_139273
Red=Cloning site Green=Tags(s) MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHMGHARS YISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRPEAAQLLEDVQAALKPFSVKL NETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNS IFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFASSEK HSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSA MAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDA LKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAEL NKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGA VEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNILPELGVRFE DHEGLPTVVKLVDRNTLLKEREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSK FDENVSMVCPHMTWRAKSSAKGKPRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 82.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_644802 |
| Locus ID | 833 |
| UniProt ID | P49589 |
| Refseq Size | 2536 |
| Cytogenetics | 11p15.4 |
| Refseq ORF | 2178 |
| Synonyms | CARS; CYSRS; MCDDBH; MDBH; MGC:11246 |
| Summary | This gene encodes a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain on chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Aug 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Aminoacyl-tRNA biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408331 | CARS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423062 | CARS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408331 | Transient overexpression lysate of cysteinyl-tRNA synthetase (CARS), transcript variant 1 |
CNY 4840.00 |
|
| LY423062 | Transient overexpression lysate of cysteinyl-tRNA synthetase (CARS), transcript variant 3 |
CNY 4840.00 |
|
| PH324092 | CARS MS Standard C13 and N15-labeled recombinant protein (NP_001014437) |
CNY 14250.00 |
|
| PH324149 | CARS MS Standard C13 and N15-labeled recombinant protein (NP_644802) |
CNY 19520.00 |
|
| TP324092 | Recombinant protein of human cysteinyl-tRNA synthetase (CARS), transcript variant 3, 20 µg |
CNY 2900.00 |
