Alkaline Phosphatase (ALPI) (NM_001631) Human Recombinant Protein
CAT#: TP324178
Recombinant protein of human alkaline phosphatase, intestinal (ALPI), 20 µg
View other "Alkaline Phosphatase" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224178 representing NM_001631
Red=Cloning site Green=Tags(s) MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTA TRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQC NTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLI SNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQS VTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEA VMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPY TACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.7 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001622 |
Locus ID | 248 |
UniProt ID | P09923 |
Refseq Size | 2516 |
Cytogenetics | 2q37.1 |
Refseq ORF | 1584 |
Synonyms | IAP |
Summary | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Multiplexed single-molecule enzyme activity analysis for counting disease-related proteins in biological samples
,Sakamoto, S;Komatsu, T;Watanabe, R;Zhang, Y;Inoue, T;Kawaguchi, M;Nakagawa, H;Ueno, T;Okusaka, T;Honda, K;Noji, H;Urano, Y;,
Sci Adv
,PubMed ID 32195342
[ALPI]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400612 | ALPI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400612 | Transient overexpression lysate of alkaline phosphatase, intestinal (ALPI) |
CNY 4840.00 |
|
PH324178 | ALPI MS Standard C13 and N15-labeled recombinant protein (NP_001622) |
CNY 19520.00 |
其它Alkaline Phosphatase产品